PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc06_g12880
Common NameGSCOC_T00041480001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family HD-ZIP
Protein Properties Length: 180aa    MW: 20029.8 Da    PI: 10.0073
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc06_g12880genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1955108356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+ +++keq  +Le+ F+ +++p+++ + eLA++lgL  rqV +WFqNrRa+ k
  Cc06_g12880  55 KKSRLSKEQAAVLEANFNDHPNPDTALKNELADRLGLFPRQVDIWFQNRRARTK 108
                  56789***********************************************98 PP

2HD-ZIP_I/II90.32.3e-2955141288
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                  kk rlskeq+++LE +F+ + + ++  K+ela +Lgl prqv++WFqnrRARtk+k+  +++e+Lk+ +++l een +L++e e+ +
  Cc06_g12880  55 KKSRLSKEQAAVLEANFNDHPNPDTALKNELADRLGLFPRQVDIWFQNRRARTKSKKNVSECERLKQVCKNLIEENLKLSEEIEKQK 141
                  9*******************************************************************************9998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.34650110IPR001356Homeobox domain
SMARTSM003892.6E-1652114IPR001356Homeobox domain
SuperFamilySSF466893.76E-1652109IPR009057Homeodomain-like
CDDcd000867.70E-1655111No hitNo description
PfamPF000461.5E-1655108IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-1857112IPR009057Homeodomain-like
PRINTSPR000315.6E-58190IPR000047Helix-turn-helix motif
PRINTSPR000315.6E-590106IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEARENSNTQ LPLALGPRKN TKRGPRKNTK RVLSLELSLG AQQVQGRGSS DENAKKSRLS  60
KEQAAVLEAN FNDHPNPDTA LKNELADRLG LFPRQVDIWF QNRRARTKSK KNVSECERLK  120
QVCKNLIEEN LKLSEEIEKQ KALATGDQKG AFYAYGLSGY VLVCPVCHQQ YLIGSCGAM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068U3751e-131A0A068U375_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-27homeobox from Arabidopsis thaliana